Millipore Sigma Vibrant Logo
Attention: We have moved. EMD Millipore products are no longer available for purchase on emdmillipore.com.Learn More

05-23-2005 Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

Overview

Replacement Information

Key Specifications Table

CAS #Empirical Formula
90880-35-6C₁₈₉H₂₈₅N₅₅O₅₇S

Products

Catalog NumberPackaging Qty/Pack
05-23-2005-0.5MG Glass bottle .5 mg
05-23-2005-1MG Plastic ampoule 1 mg
Description
OverviewA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
Catalogue Number05-23-2005
Brand Family Calbiochem®
SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
References
ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
Wahlestedt, C., et al. 1993. Science 259, 528.
Leibowitz, S.F. 1992. NeuroReport 3, 1023.
Product Information
CAS number90880-35-6
ATP CompetitiveN
FormWhite to off-white lyophilized solid
FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
Hill FormulaC₁₈₉H₂₈₅N₅₅O₅₇S
Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
ReversibleY
Sold on the basis of peptide contentY
Quality LevelMQ100
Applications
Biological Information
Primary TargetA potent vasoconstrictor
Purity≥97% by HPLC
Physicochemical Information
Cell permeableN
Peptide ContentY
Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
R PhraseR: 20/21/22

Harmful by inhalation, in contact with skin and if swallowed.
S PhraseS: 36

Wear suitable protective clothing.
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Harmful
Storage -20°C
Protect from Moisture Protect from moisture
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade Item Number
Catalog Number GTIN
05-23-2005-0.5MG 04055977206371
05-23-2005-1MG 04055977206388

Documentation

Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem SDS

Title

Safety Data Sheet (SDS) 

Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificates of Analysis

TitleLot Number
05-23-2005

References

Reference overview
Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
Wahlestedt, C., et al. 1993. Science 259, 528.
Leibowitz, S.F. 1992. NeuroReport 3, 1023.
Data Sheet

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision18-September-2008 RFH
SynonymsNPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
DescriptionA potent vasoconstrictor. Reversibly inhibits Ca2+-activated K+ channels in vascular smooth muscle cells.
FormWhite to off-white lyophilized solid
FormulationSupplied as trifluoroacetate salt. Sold on the basis of peptide content.
CAS number90880-35-6
Chemical formulaC₁₈₉H₂₈₅N₅₅O₅₇S
Peptide SequenceH-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂
Purity≥97% by HPLC
Solubility5% Acetic acid (1 mg/ml)
Storage Protect from moisture
-20°C
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
Toxicity Harmful
Merck USA index14, 6485
ReferencesXiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
Wahlestedt, C., et al. 1993. Science 259, 528.
Leibowitz, S.F. 1992. NeuroReport 3, 1023.