Our broad portfolio consists of multiplex panels that allow you to choose, within the panel, analytes that best meet your needs. On a separate tab you can choose the premixed cytokine format or a single plex kit.
Cell Signaling Kits & MAPmates™
Choose fixed kits that allow you to explore entire pathways or processes. Or design your own kits by choosing single plex MAPmates™, following the provided guidelines.
The following MAPmates™ should not be plexed together:
-MAPmates™ that require a different assay buffer
-Phospho-specific and total MAPmate™ pairs, e.g. total GSK3β and GSK3β (Ser 9)
-PanTyr and site-specific MAPmates™, e.g. Phospho-EGF Receptor and phospho-STAT1 (Tyr701)
-More than 1 phospho-MAPmate™ for a single target (Akt, STAT3)
-GAPDH and β-Tubulin cannot be plexed with kits or MAPmates™ containing panTyr
.
Catalog Number
Ordering Description
Qty/Pack
List
This item has been added to favorites.
Select A Species, Panel Type, Kit or Sample Type
To begin designing your MILLIPLEX® MAP kit select a species, a panel type or kit of interest.
Custom Premix Selecting "Custom Premix" option means that all of the beads you have chosen will be premixed in manufacturing before the kit is sent to you.
If you have chosen panel analytes and then choose a premix or single plex kit, you will lose that customization.
Catalogue Number
Ordering Description
Qty/Pack
List
This item has been added to favorites.
Species
Panel Type
Selected Kit
Qty
Catalog Number
Ordering Description
Qty/Pack
List Price
96-Well Plate
Qty
Catalog Number
Ordering Description
Qty/Pack
List Price
Add Additional Reagents (Buffer and Detection Kit is required for use with MAPmates)
Qty
Catalog Number
Ordering Description
Qty/Pack
List Price
48-602MAG
Buffer Detection Kit for Magnetic Beads
1 Kit
Space Saver Option Customers purchasing multiple kits may choose to save storage space by eliminating the kit packaging and receiving their multiplex assay components in plastic bags for more compact storage.
This item has been added to favorites.
The Product Has Been Added To Your Cart
You can now customize another kit, choose a premixed kit, check out or close the ordering tool.
The quantity field is empty. Please enter a quantity of 1 or more to add items to your cart.
Description
Overview
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 µM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 µM) and VLDL receptors (IC50 = 4.7 µM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 µM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 µM).
Please note that the molecular weight for this compound is batch-specific due to variable water content.
Catalogue Number
508761
Brand Family
Calbiochem®
References
References
Shan L, et al. 2008. Biochem Biophys Res Commun.375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem.282, 18602.
Shan L, et al. 2008. Biochem Biophys Res Commun.375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem.282, 18602.
Data Sheet
Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.
Revision
19-December-2014 JSW
Description
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A. Binds to the proprotein convertase subtilisin/kexin type 9 (PCSK9) in a pH and calcium-dependent manner (Kd = 300 nM at pH 5.2 and 1.0 µM at pH7.4 and at 2 mM calcium) and blocks its interaction with LDL receptors (IC50 = 3.4 µM) and VLDL receptors (IC50 = 4.7 µM). Acts as a poor inhibitor of PCSK9 - Apo-ER2 interaction even at high concentrations (~200 µM). Blocks the degradation of mature LDL receptors in HepG2 cells in a dose-dependent manner (~1.5 to 15 µM).