Millipore Sigma Vibrant Logo

613571 TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem

Overview

Replacement Information

Key Specifications Table

Empirical Formula
C₁₆₃H₂₆₈N₅₂O₃₈S

Pricing & Availability

Catalog Number AvailabilityPackaging Qty/Pack Price Quantity
613571-1MG
Retrieving availability...
Limited Availability
Limited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Plastic ampoule 1 mg
      Retrieving price...
      Price could not be retrieved
      Minimum Quantity is a multiple of
      Maximum Quantity is
      Upon Order Completion More Information
      You Saved ()
       
      Request Pricing
      Description
      OverviewA cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      Catalogue Number613571
      Brand Family Calbiochem®
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      References
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetControl for TIRAP inhibitor
      Purity≥97% by HPLC
      Physicochemical Information
      Cell permeableY
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalog Number GTIN
      613571-1MG 04055977263565

      Documentation

      TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      TIRAP Inhibitor Peptide, Control, Cell-Permeable - Calbiochem Certificates of Analysis

      TitleLot Number
      613571

      References

      Reference overview
      Horng, T., et al. 2001. Nat. Immunol. 2, 835.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision12-September-2008 RFH
      SynonymsAnt-Tirap151-138, TIRAP Peptide, Control, Mal Peptide, MyD88-Adapter Like Peptide, Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide, (RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
      DescriptionA cell-permeable synthetic peptide containing mouse toll-interleukin 1 receptor (TIR) domain-containing adapter protein 151-138 reverse sequence (TIRAP; also called Mal (MyD88-adapter-like), fused to the Drosophila antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570).
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₁₆₃H₂₆₈N₅₂O₃₈S
      Peptide SequenceH-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH
      Purity≥97% by HPLC
      SolubilityDMSO (5 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesHorng, T., et al. 2001. Nat. Immunol. 2, 835.