05-23-2405 Calcitonin Gene-Related Peptide-II, Human
Recommended Products
Overview
Replacement Information |
---|
Key Specifications Table
CAS # | Empirical Formula |
---|---|
98824-26-1 | C₁₆₂H₂₆₇N₅₁O₄₈S₃ |
Description | |
---|---|
Overview | Potent hypotensive agent and vasodilator. |
Catalogue Number | 05-23-2405 |
Brand Family | Calbiochem® |
Synonyms | CGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂ |
References | |
---|---|
References | Henke, H., et al. 1987. Brain Res. 410, 404. Finberg, R.W., et al. 1986. FEBS Lett. 209, 97. Finberg, R.W., et al. 1985. FEBS Lett. 183, 403. |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥95% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information | |
---|---|
R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
S Phrase | S: 36 Wear suitable protective clothing. |
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalog Number | GTIN |
05-23-2405 | 0 |
Documentation
Calcitonin Gene-Related Peptide-II, Human Certificates of Analysis
Title | Lot Number |
---|---|
05-23-2405 |
References
Reference overview |
---|
Henke, H., et al. 1987. Brain Res. 410, 404. Finberg, R.W., et al. 1986. FEBS Lett. 209, 97. Finberg, R.W., et al. 1985. FEBS Lett. 183, 403. |