Millipore Sigma Vibrant Logo

219483 Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem

View Products on Sigmaaldrich.com
219483
  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Limited Availability
Limited Availability
Stocked 
Discontinued
Limited Quantities Available
Available
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Specifications Table

      Empirical Formula
      C₂₂₈H₃₃₅N₆₁O₄₉S
      Description
      Overview

      This product has been discontinued.



      A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

      Catalogue Number219483
      Brand Family Calbiochem®
      SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
      References
      ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Product Information
      ATP CompetitiveN
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Hill FormulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Hygroscopic Hygroscopic
      ReversibleN
      Quality LevelMQ100
      Applications
      Biological Information
      Primary TargetNegative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
      Purity≥95% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Shipped with Blue Ice or with Dry Ice
      Toxicity Standard Handling
      Storage -20°C
      Protect from Light Protect from light
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Packaged under inert gas Packaged under inert gas
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Catalog Number GTIN
      219483 0

      Documentation

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem SDS

      Title

      Safety Data Sheet (SDS) 

      Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem Certificates of Analysis

      TitleLot Number
      219483

      References

      Reference overview
      Gratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision16-November-2020 JSW
      SynonymsAP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
      DescriptionA scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).
      FormWhite lyophilized solid
      FormulationSupplied as a trifluoroacetate salt.
      Intert gas (Yes/No) Packaged under inert gas
      Chemical formulaC₂₂₈H₃₃₅N₆₁O₄₉S
      Peptide SequenceArg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Phe-Phe-Thr-Thr-Ser-Thr-Val-Thr-Tyr-Lys-Trp-Phe-Arg-Tyr-OH
      Purity≥95% by HPLC
      SolubilityDMSO (2 mg/ml)
      Storage Protect from light
      -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Standard Handling
      ReferencesGratton, J.P., et al. 2003. Cancer Cell 4, 31.
      Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716.
      Bucci, M., et al. 2000. Nat. Med. 6, 1362.