219483 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem
Synonyms: AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
Recommended Products
Overview
Replacement Information |
---|
Key Specifications Table
Empirical Formula |
---|
C₂₂₈H₃₃₅N₆₁O₄₉S |
Description | |
---|---|
Overview | This product has been discontinued. A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
Catalogue Number | 219483 |
Brand Family | Calbiochem® |
Synonyms | AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY |
References | |
---|---|
References | Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |
Product Information | |
---|---|
ATP Competitive | N |
Form | White lyophilized solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Hygroscopic | Hygroscopic |
Reversible | N |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). |
Purity | ≥95% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade Item Number | |
---|---|
Catalog Number | GTIN |
219483 | 0 |
Documentation
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem SDS
Title |
---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control - Calbiochem Certificates of Analysis
Title | Lot Number |
---|---|
219483 |
References
Reference overview |
---|
Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. |